Products

CXCL9 (C-X-C motif chemokine 9), Human

CXCL9, also named Monokine, is a member of the CXC chemokine family and is induced by gamma interferon (MIG). Following induced by IFN-gamma, this chemokine can attract T-cells . CXCL9 has close relationship with two other CXC chemokines named CXCL10 and CXCL11, additionally they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 is also a cytokine that affects the growth, movement, or activation state of cells participating in immune and inflammatory response and work as a chemoattractant of activated T-cells.
No. Size Price Qty Status
C01134-5UG 5 ug $108.00 Inquiry
C01134-20UG 20 ug $268.00 Inquiry
C01134-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRK
SQRSRQKKTT with polyhistidine tag at the N-terminus

UnitProt ID:
Q07325
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR3. The ED50 for this effect is <0.5 μg/mL.
 
Purity:
>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice